Lineage for d1ovqa_ (1ovq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886951Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)
    automatically mapped to Pfam PF03652
  6. 2886952Protein Hypothetical protein YqgF (RuvX) [102486] (1 species)
  7. 2886953Species Escherichia coli [TaxId:562] [102487] (3 PDB entries)
  8. 2886958Domain d1ovqa_: 1ovq A: [93607]
    structural genomics

Details for d1ovqa_

PDB Entry: 1ovq (more details)

PDB Description: solution structure of the hypothetical protein yqgf from escherichia coli
PDB Compounds: (A:) Hypothetical protein yqgF

SCOPe Domain Sequences for d1ovqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovqa_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}
msgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivg
lplnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgk
vdsasaviilesyfeqgy

SCOPe Domain Coordinates for d1ovqa_:

Click to download the PDB-style file with coordinates for d1ovqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ovqa_: