SCOP 1.71: Domain d1ovnb2: 1ovn B:23-145

Lineage for d1ovnb2 (1ovn B:23-145)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.7: ERP29 N domain-like [52892] (2 proteins)

6. Protein Windbeutel, N-terminal domain [102444] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (1 PDB entry)

8. Domain d1ovnb2: 1ovn B:23-145 [93605]
   Other proteins in same PDB: d1ovna1, d1ovnb1
   complexed with cs

Details for d1ovnb2

PDB Entry: 1ovn, 1.9 Å

PDB Description: crystal structure and functional analysis of drosophila wind-- a pdi- related protein

SCOP Domain Sequences for d1ovnb2:

Sequence; same for both SEQRES and ATOM records:

>d1ovnb2 c.47.1.7 (B:23-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster)}
tctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvg
vkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantpl
yig

Timeline for d1ovnb2:

• d1ovnb2 first appeared in SCOP 1.67
  
• d1ovnb2 appears in SCOP 1.69
  
• d1ovnb2 appears in SCOP 1.73
  
• d1ovnb2 appears in the current release, SCOPe 2.08