![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins) automatically mapped to Pfam PF07912 |
![]() | Domain d1ovnb2: 1ovn B:23-145 [93605] Other proteins in same PDB: d1ovna1, d1ovnb1 complexed with cs |
PDB Entry: 1ovn (more details), 1.9 Å
SCOPe Domain Sequences for d1ovnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovnb2 c.47.1.7 (B:23-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvg vkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantpl yig
Timeline for d1ovnb2: