Lineage for d1ovnb2 (1ovn B:23-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877366Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
    automatically mapped to Pfam PF07912
  6. Protein Windbeutel, N-terminal domain [102444] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (1 PDB entry)
  8. 2877373Domain d1ovnb2: 1ovn B:23-145 [93605]
    Other proteins in same PDB: d1ovna1, d1ovnb1
    complexed with cs

Details for d1ovnb2

PDB Entry: 1ovn (more details), 1.9 Å

PDB Description: crystal structure and functional analysis of drosophila wind-- a pdi- related protein
PDB Compounds: (B:) Windbeutel

SCOPe Domain Sequences for d1ovnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovnb2 c.47.1.7 (B:23-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvg
vkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantpl
yig

SCOPe Domain Coordinates for d1ovnb2:

Click to download the PDB-style file with coordinates for d1ovnb2.
(The format of our PDB-style files is described here.)

Timeline for d1ovnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ovnb1