SCOP 1.69: Domain d1ovnb1: 1ovn B:146-248

Lineage for d1ovnb1 (1ovn B:146-248)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.1: ERP29 C domain-like [47933] (1 family)

5. Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)

6. Protein Windbeutel, C-terminal domain [101269] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (1 PDB entry)

8. Domain d1ovnb1: 1ovn B:146-248 [93604]
   Other proteins in same PDB: d1ovna2, d1ovnb2

Details for d1ovnb1

PDB Entry: 1ovn, 1.9 Å

PDB Description: crystal structure and functional analysis of drosophila wind-- a pdi- related protein

SCOP Domain Sequences for d1ovnb1:

Sequence; same for both SEQRES and ATOM records:

>d1ovnb1 a.71.1.1 (B:146-248) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster)}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvt

Timeline for d1ovnb1:

• d1ovnb1 first appeared in SCOP 1.67
  
• d1ovnb1 appears in SCOP 1.71
  
• d1ovnb1 appears in the current release, SCOPe 2.08