Class a: All alpha proteins [46456] (290 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) automatically mapped to Pfam PF07749 |
Family a.71.1.1: ERP29 C domain-like [47934] (3 proteins) |
Domain d1ovnb1: 1ovn B:146-248 [93604] Other proteins in same PDB: d1ovna2, d1ovnb2 complexed with cs |
PDB Entry: 1ovn (more details), 1.9 Å
SCOPe Domain Sequences for d1ovnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovnb1 a.71.1.1 (B:146-248) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvt
Timeline for d1ovnb1: