SCOPe 2.05: Domain d1ovna2: 1ovn A:24-145

Lineage for d1ovna2 (1ovn A:24-145)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
   automatically mapped to Pfam PF07912

6. Protein Windbeutel, N-terminal domain [102444] (1 species)
7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (1 PDB entry)

8. Domain d1ovna2: 1ovn A:24-145 [93603]
   Other proteins in same PDB: d1ovna1, d1ovnb1
   complexed with cs

Details for d1ovna2

PDB Entry: 1ovn, 1.9 Å

PDB Description: crystal structure and functional analysis of drosophila wind-- a pdi- related protein

PDB Compounds: (A:) Windbeutel

SCOPe Domain Sequences for d1ovna2:

Sequence; same for both SEQRES and ATOM records:

>d1ovna2 c.47.1.7 (A:24-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

Timeline for d1ovna2:

• d1ovna2 first appeared in SCOP 1.67
  
• d1ovna2 appears in SCOPe 2.04
  
• d1ovna2 appears in SCOPe 2.06
  
• d1ovna2 appears in the current release, SCOPe 2.08