Lineage for d1ovdb_ (1ovd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080046Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2080084Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries)
  8. 2080102Domain d1ovdb_: 1ovd B: [93594]
    complexed with fmn, gol, mg, oro; mutant

Details for d1ovdb_

PDB Entry: 1ovd (more details), 2.25 Å

PDB Description: the k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a in complex with orotate
PDB Compounds: (B:) dihydroorotate dehydrogenase a

SCOPe Domain Sequences for d1ovdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovdb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgepqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d1ovdb_:

Click to download the PDB-style file with coordinates for d1ovdb_.
(The format of our PDB-style files is described here.)

Timeline for d1ovdb_: