Lineage for d1ov8d_ (1ov8 D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043108Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2043179Protein Auracyanin [63686] (1 species)
    azurin-related protein
  7. 2043180Species Chloroflexus aurantiacus [TaxId:1108] [63687] (2 PDB entries)
  8. 2043185Domain d1ov8d_: 1ov8 D: [93590]
    complexed with cl, cu, so4

Details for d1ov8d_

PDB Entry: 1ov8 (more details), 1.9 Å

PDB Description: Auracyanin B structure in space group, P65
PDB Compounds: (D:) Auracyanin B

SCOPe Domain Sequences for d1ov8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ov8d_ b.6.1.1 (D:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]}
anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl
vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi
ctfpghylagmkgtltvtp

SCOPe Domain Coordinates for d1ov8d_:

Click to download the PDB-style file with coordinates for d1ov8d_.
(The format of our PDB-style files is described here.)

Timeline for d1ov8d_: