Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Auracyanin [63686] (1 species) azurin-related protein |
Species Chloroflexus aurantiacus [TaxId:1108] [63687] (2 PDB entries) |
Domain d1ov8c_: 1ov8 C: [93589] complexed with cl, cu, so4 |
PDB Entry: 1ov8 (more details), 1.9 Å
SCOPe Domain Sequences for d1ov8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ov8c_ b.6.1.1 (C:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi ctfpghylagmkgtltvtp
Timeline for d1ov8c_: