Lineage for d1ov4a_ (1ov4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109948Protein Hydroxysteroid sulfotransferase sult2a1 [52578] (1 species)
  7. 2109949Species Human (Homo sapiens) [TaxId:9606] [52579] (6 PDB entries)
  8. 2109958Domain d1ov4a_: 1ov4 A: [93581]
    complexed with aox, so4

Details for d1ov4a_

PDB Entry: 1ov4 (more details), 2.7 Å

PDB Description: Crystal structure of human DHEA-ST complexed with androsterone
PDB Compounds: (A:) alcohol sulfotransferase

SCOPe Domain Sequences for d1ov4a_:

Sequence, based on SEQRES records: (download)

>d1ov4a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
nprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd
ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe

Sequence, based on observed residues (ATOM records): (download)

>d1ov4a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
nprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkeyvvdktqlsgdwknhf
tvaqaedfdklfqekmadlprelfpwe

SCOPe Domain Coordinates for d1ov4a_:

Click to download the PDB-style file with coordinates for d1ov4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ov4a_: