Lineage for d1ouwd_ (1ouw D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676676Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 676694Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 676695Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)
  6. 676724Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 676725Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (1 PDB entry)
  8. 676729Domain d1ouwd_: 1ouw D: [93574]
    complexed with edo, imd, mlt

Details for d1ouwd_

PDB Entry: 1ouw (more details), 1.37 Å

PDB Description: Crystal structure of Calystegia sepium agglutinin
PDB Compounds: (D:) lectin

SCOP Domain Sequences for d1ouwd_:

Sequence, based on SEQRES records: (download)

>d1ouwd_ b.77.3.1 (D:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrhk

Sequence, based on observed residues (ATOM records): (download)

>d1ouwd_ b.77.3.1 (D:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssavvgneivgflgrsgyyvdaigtynrhk

SCOP Domain Coordinates for d1ouwd_:

Click to download the PDB-style file with coordinates for d1ouwd_.
(The format of our PDB-style files is described here.)

Timeline for d1ouwd_: