![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
![]() | Protein Calystegia sepium agglutinin [101948] (1 species) |
![]() | Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (3 PDB entries) |
![]() | Domain d1ouwc_: 1ouw C: [93573] complexed with edo, imd, mlt |
PDB Entry: 1ouw (more details), 1.37 Å
SCOPe Domain Sequences for d1ouwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouwc_ b.77.3.1 (C:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]} avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp fssanvvgneivgflgrsgyyvdaigtynrhk
Timeline for d1ouwc_: