Lineage for d1ouwc_ (1ouw C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566741Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 566759Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 566760Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)
  6. 566789Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 566790Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (1 PDB entry)
  8. 566793Domain d1ouwc_: 1ouw C: [93573]

Details for d1ouwc_

PDB Entry: 1ouw (more details), 1.37 Å

PDB Description: Crystal structure of Calystegia sepium agglutinin

SCOP Domain Sequences for d1ouwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouwc_ b.77.3.1 (C:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium)}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrhk

SCOP Domain Coordinates for d1ouwc_:

Click to download the PDB-style file with coordinates for d1ouwc_.
(The format of our PDB-style files is described here.)

Timeline for d1ouwc_: