Lineage for d1ouwa_ (1ouw A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566741Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 566759Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 566760Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)
  6. 566789Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 566790Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (1 PDB entry)
  8. 566791Domain d1ouwa_: 1ouw A: [93571]

Details for d1ouwa_

PDB Entry: 1ouw (more details), 1.37 Å

PDB Description: Crystal structure of Calystegia sepium agglutinin

SCOP Domain Sequences for d1ouwa_:

Sequence, based on SEQRES records: (download)

>d1ouwa_ b.77.3.1 (A:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium)}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrh

Sequence, based on observed residues (ATOM records): (download)

>d1ouwa_ b.77.3.1 (A:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium)}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvneivgflgrsgyyvdaigtynrh

SCOP Domain Coordinates for d1ouwa_:

Click to download the PDB-style file with coordinates for d1ouwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ouwa_: