Lineage for d1ouwa_ (1ouw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068877Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2068917Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2068918Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2068947Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 2068948Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (3 PDB entries)
  8. 2068949Domain d1ouwa_: 1ouw A: [93571]
    complexed with edo, imd, mlt

Details for d1ouwa_

PDB Entry: 1ouw (more details), 1.37 Å

PDB Description: Crystal structure of Calystegia sepium agglutinin
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1ouwa_:

Sequence, based on SEQRES records: (download)

>d1ouwa_ b.77.3.1 (A:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrh

Sequence, based on observed residues (ATOM records): (download)

>d1ouwa_ b.77.3.1 (A:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvneivgflgrsgyyvdaigtynrh

SCOPe Domain Coordinates for d1ouwa_:

Click to download the PDB-style file with coordinates for d1ouwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ouwa_: