Lineage for d1ouva_ (1ouv A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360193Superfamily a.118.18: HCP-like [81901] (1 family) (S)
  5. 360194Family a.118.18.1: HCP-like [81902] (2 proteins)
    Helicobacter Cysteine-rich Protein
    this is a repeat family; one repeat unit is 1ouv A:184-220 found in domain
  6. 360198Protein Cysteine rich protein C (HcpC) [101415] (1 species)
  7. 360199Species Helicobacter pylori [TaxId:210] [101416] (1 PDB entry)
  8. 360200Domain d1ouva_: 1ouv A: [93570]

Details for d1ouva_

PDB Entry: 1ouv (more details), 2 Å

PDB Description: Helicobacter cysteine rich protein C (HcpC)

SCOP Domain Sequences for d1ouva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori}
dpkelvglgaksykekdftqakkyfekacdlkensgcfnlgvlyyqgqgveknlkkaasf
yakacdlnysngchllgnlyysgqgvsqntnkalqyyskacdlkyaegcaslggiyhdgk
vvtrdfkkaveyftkacdlndgdgctilgslydagrgtpkdlkkalasydkacdlkdspg
cfnagnmyhhgegatknfkealaryskacelengggcfnlgamqyngegvtrnekqaien
fkkgcklgakgacdilkqlkikvhh

SCOP Domain Coordinates for d1ouva_:

Click to download the PDB-style file with coordinates for d1ouva_.
(The format of our PDB-style files is described here.)

Timeline for d1ouva_: