Lineage for d1ousb_ (1ous B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569076Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 569077Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) (S)
  5. 569078Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)
  6. 569079Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 569080Species Pseudomonas aeruginosa [TaxId:287] [82029] (8 PDB entries)
  8. 569094Domain d1ousb_: 1ous B: [93567]

Details for d1ousb_

PDB Entry: 1ous (more details), 1.2 Å

PDB Description: Lecb (PA-LII) calcium-free

SCOP Domain Sequences for d1ousb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ousb_ b.115.1.1 (B:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOP Domain Coordinates for d1ousb_:

Click to download the PDB-style file with coordinates for d1ousb_.
(The format of our PDB-style files is described here.)

Timeline for d1ousb_: