SCOPe 2.05: Domain d1ousa_: 1ous A:

Lineage for d1ousa_ (1ous A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
   automatically mapped to Pfam PF07472

6. Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries)
   Uniprot Q9HYN5 # PA3361

8. Domain d1ousa_: 1ous A: [93566]
   complexed with so4

Details for d1ousa_

PDB Entry: 1ous, 1.2 Å

PDB Description: Lecb (PA-LII) calcium-free

PDB Compounds: (A:) hypothetical protein LecB

SCOPe Domain Sequences for d1ousa_:

Sequence; same for both SEQRES and ATOM records:

>d1ousa_ b.115.1.1 (A:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d1ousa_:

• d1ousa_ first appeared in SCOP 1.67
  
• d1ousa_ appears in SCOPe 2.04
  
• d1ousa_ appears in SCOPe 2.06
  
• d1ousa_ appears in the current release, SCOPe 2.08