Lineage for d1ouqf2 (1ouq F:130-341)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047274Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1047275Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1047276Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 1047277Protein Cre recombinase [56355] (1 species)
  7. 1047278Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1047326Domain d1ouqf2: 1ouq F:130-341 [93564]
    Other proteins in same PDB: d1ouqa1, d1ouqb1, d1ouqe1, d1ouqf1
    protein/DNA complex; complexed with iod, mg

Details for d1ouqf2

PDB Entry: 1ouq (more details), 3.2 Å

PDB Description: Crystal structure of wild-type Cre recombinase-loxP synapse
PDB Compounds: (F:) cre recombinase

SCOPe Domain Sequences for d1ouqf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouqf2 d.163.1.1 (F:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOPe Domain Coordinates for d1ouqf2:

Click to download the PDB-style file with coordinates for d1ouqf2.
(The format of our PDB-style files is described here.)

Timeline for d1ouqf2: