SCOPe 2.01: Domain d1ouqa1: 1ouq A:10-129

Lineage for d1ouqa1 (1ouq A:10-129)

Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds)
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)
Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
Protein Cre recombinase [47825] (1 species)
Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
Uniprot P06956 20-341
Domain d1ouqa1: 1ouq A:10-129 [93557]
Other proteins in same PDB: d1ouqa2, d1ouqb2, d1ouqe2, d1ouqf2
protein/DNA complex; complexed with iod, mg

Details for d1ouqa1

PDB Entry: 1ouq (more details), 3.2 Å

PDB Description: Crystal structure of wild-type Cre recombinase-loxP synapse

PDB Compounds: (A:) cre recombinase

SCOPe Domain Sequences for d1ouqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouqa1 a.60.9.1 (A:10-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
nlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepe
dvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d1ouqa1:

Click to download the PDB-style file with coordinates for d1ouqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ouqa1: