Lineage for d1oupb_ (1oup B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1889894Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1889895Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1890015Family d.4.1.6: Endonuclease I [102726] (2 proteins)
    automatically mapped to Pfam PF04231
  6. 1890016Protein Periplasmic endonuclease Vvn [102727] (1 species)
  7. 1890017Species Vibrio vulnificus [TaxId:672] [102728] (2 PDB entries)
  8. 1890020Domain d1oupb_: 1oup B: [93556]
    complexed with DNA
    protein/DNA complex; complexed with ca

Details for d1oupb_

PDB Entry: 1oup (more details), 2.3 Å

PDB Description: crystal structure of the periplasmic endonuclease vvn complexed with octamer double stranded dna
PDB Compounds: (B:) Nuclease

SCOPe Domain Sequences for d1oupb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oupb_ d.4.1.6 (B:) Periplasmic endonuclease Vvn {Vibrio vulnificus [TaxId: 672]}
appssfsaakqqavkiyqdhpisfycgcdiewqgkkgipnletcgyqvrkqqtrasriew
eavvpawqfghhrqcwqkggrkncskndqqfrlmeadlhnltpaigevngdrsnfnfsqw
ngvdgvsygrcemqvnfkqrkvmppdrargsiartylymsqeygfqlskqqqqlmqawnk
sypvdewectrddriakiqgnhnpfvqqsc

SCOPe Domain Coordinates for d1oupb_:

Click to download the PDB-style file with coordinates for d1oupb_.
(The format of our PDB-style files is described here.)

Timeline for d1oupb_: