SCOP 1.67: Domain d1oulb_: 1oul B:

Lineage for d1oulb_ (1oul B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)

6. Protein Stringent starvation protein B, SspB [101740] (2 species)
   a specificity-enhancing factor for the ClpXP proteolytic machine

7. Species Haemophilus influenzae [TaxId:727] [101742] (3 PDB entries)

8. Domain d1oulb_: 1oul B: [93550]

Details for d1oulb_

PDB Entry: 1oul, 2.2 Å

PDB Description: Structure of the AAA+ protease delivery protein SspB

SCOP Domain Sequences for d1oulb_:

Sequence; same for both SEQRES and ATOM records:

>d1oulb_ b.136.1.1 (B:) Stringent starvation protein B, SspB {Haemophilus influenzae}
spkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlqlt
ndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteqptgfy
e

Timeline for d1oulb_:

• d1oulb_ is new in SCOP 1.67
  
• d1oulb_ appears in SCOP 1.69
  
• d1oulb_ appears in the current release, SCOPe 2.08