Lineage for d1ou9c_ (1ou9 C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383534Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 383535Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) (S)
  5. 383536Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 383537Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 383549Species Haemophilus influenzae [TaxId:727] [101742] (3 PDB entries)
  8. 383554Domain d1ou9c_: 1ou9 C: [93547]
    complexed with ca

Details for d1ou9c_

PDB Entry: 1ou9 (more details), 1.8 Å

PDB Description: Structure of SspB, a AAA+ protease delivery protein

SCOP Domain Sequences for d1ou9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou9c_ b.136.1.1 (C:) Stringent starvation protein B, SspB {Haemophilus influenzae}
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteqp

SCOP Domain Coordinates for d1ou9c_:

Click to download the PDB-style file with coordinates for d1ou9c_.
(The format of our PDB-style files is described here.)

Timeline for d1ou9c_: