Lineage for d1ou9a_ (1ou9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433461Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2433462Superfamily b.136.1: SspB-like [101738] (3 families) (S)
  5. 2433463Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
    automatically mapped to Pfam PF04386
  6. 2433464Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 2433476Species Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries)
    Uniprot P45206 5-110
  8. 2433481Domain d1ou9a_: 1ou9 A: [93545]
    complexed with ca

Details for d1ou9a_

PDB Entry: 1ou9 (more details), 1.8 Å

PDB Description: Structure of SspB, a AAA+ protease delivery protein
PDB Compounds: (A:) Stringent starvation protein B homolog

SCOPe Domain Sequences for d1ou9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou9a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]}
meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
p

SCOPe Domain Coordinates for d1ou9a_:

Click to download the PDB-style file with coordinates for d1ou9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ou9a_: