Class b: All beta proteins [48724] (144 folds) |
Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) |
Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein) |
Protein Stringent starvation protein B, SspB [101740] (2 species) a specificity-enhancing factor for the ClpXP proteolytic machine |
Species Haemophilus influenzae [TaxId:727] [101742] (3 PDB entries) |
Domain d1ou9a_: 1ou9 A: [93545] |
PDB Entry: 1ou9 (more details), 1.8 Å
SCOP Domain Sequences for d1ou9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ou9a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae} meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq p
Timeline for d1ou9a_: