Lineage for d1ou9a_ (1ou9 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473105Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 473106Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) (S)
  5. 473107Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 473108Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 473120Species Haemophilus influenzae [TaxId:727] [101742] (3 PDB entries)
  8. 473123Domain d1ou9a_: 1ou9 A: [93545]

Details for d1ou9a_

PDB Entry: 1ou9 (more details), 1.8 Å

PDB Description: Structure of SspB, a AAA+ protease delivery protein

SCOP Domain Sequences for d1ou9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou9a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae}
meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
p

SCOP Domain Coordinates for d1ou9a_:

Click to download the PDB-style file with coordinates for d1ou9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ou9a_: