Lineage for d1ou8a_ (1ou8 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088690Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2088691Superfamily b.136.1: SspB-like [101738] (3 families) (S)
  5. 2088692Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
    automatically mapped to Pfam PF04386
  6. 2088693Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 2088705Species Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries)
    Uniprot P45206 5-110
  8. 2088706Domain d1ou8a_: 1ou8 A: [93543]
    complexed with a SsrA peptide; chains C and D
    complexed with mg

Details for d1ou8a_

PDB Entry: 1ou8 (more details), 1.6 Å

PDB Description: structure of an aaa+ protease delivery protein in complex with a peptide degradation tag
PDB Compounds: (A:) Stringent starvation protein B homolog

SCOPe Domain Sequences for d1ou8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou8a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]}
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

SCOPe Domain Coordinates for d1ou8a_:

Click to download the PDB-style file with coordinates for d1ou8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ou8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ou8b_