Lineage for d1ou0c_ (1ou0 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391882Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
  5. 391883Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (2 proteins)
  6. 391891Protein Precorrin-8x methylmutase related protein [102248] (1 species)
  7. 391892Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102249] (1 PDB entry)
  8. 391895Domain d1ou0c_: 1ou0 C: [93538]

Details for d1ou0c_

PDB Entry: 1ou0 (more details), 2.1 Å

PDB Description: precorrin-8x methylmutase related protein

SCOP Domain Sequences for d1ou0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou0c_ c.23.17.1 (C:) Precorrin-8x methylmutase related protein {Archaeon Thermoplasma acidophilum}
rslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiic
dsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivig
naptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspia
asivngfgrfl

SCOP Domain Coordinates for d1ou0c_:

Click to download the PDB-style file with coordinates for d1ou0c_.
(The format of our PDB-style files is described here.)

Timeline for d1ou0c_: