Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) fold elaborated with additional structures automatically mapped to Pfam PF02570 |
Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins) |
Protein Precorrin-8x methylmutase related protein [102248] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [102249] (1 PDB entry) |
Domain d1ou0c_: 1ou0 C: [93538] structural genomics |
PDB Entry: 1ou0 (more details), 2.1 Å
SCOPe Domain Sequences for d1ou0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ou0c_ c.23.17.1 (C:) Precorrin-8x methylmutase related protein {Thermoplasma acidophilum [TaxId: 2303]} rslaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiic dsemvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivig naptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspia asivngfgrfl
Timeline for d1ou0c_: