| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) ![]() fold elaborated with additional structures automatically mapped to Pfam PF02570 |
| Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins) |
| Protein Precorrin-8x methylmutase related protein [102248] (1 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [102249] (1 PDB entry) |
| Domain d1ou0a_: 1ou0 A: [93536] structural genomics |
PDB Entry: 1ou0 (more details), 2.1 Å
SCOPe Domain Sequences for d1ou0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ou0a_ c.23.17.1 (A:) Precorrin-8x methylmutase related protein {Thermoplasma acidophilum [TaxId: 2303]}
slaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiicd
semvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivign
aptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspiaa
sivngfgrfl
Timeline for d1ou0a_: