Lineage for d1ou0a_ (1ou0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467804Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
    automatically mapped to Pfam PF02570
  5. 2467805Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 2467813Protein Precorrin-8x methylmutase related protein [102248] (1 species)
  7. 2467814Species Thermoplasma acidophilum [TaxId:2303] [102249] (1 PDB entry)
  8. 2467815Domain d1ou0a_: 1ou0 A: [93536]
    structural genomics

Details for d1ou0a_

PDB Entry: 1ou0 (more details), 2.1 Å

PDB Description: precorrin-8x methylmutase related protein
PDB Compounds: (A:) precorrin-8X methylmutase related protein

SCOPe Domain Sequences for d1ou0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou0a_ c.23.17.1 (A:) Precorrin-8x methylmutase related protein {Thermoplasma acidophilum [TaxId: 2303]}
slaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiicd
semvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivign
aptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspiaa
sivngfgrfl

SCOPe Domain Coordinates for d1ou0a_:

Click to download the PDB-style file with coordinates for d1ou0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ou0a_: