SCOP 1.69: Domain d1ou0a_: 1ou0 A:

Lineage for d1ou0a_ (1ou0 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family)
   fold elaborated with additional structures

5. Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (2 proteins)

6. Protein Precorrin-8x methylmutase related protein [102248] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102249] (1 PDB entry)

8. Domain d1ou0a_: 1ou0 A: [93536]

Details for d1ou0a_

PDB Entry: 1ou0, 2.1 Å

PDB Description: precorrin-8x methylmutase related protein

SCOP Domain Sequences for d1ou0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ou0a_ c.23.17.1 (A:) Precorrin-8x methylmutase related protein {Archaeon Thermoplasma acidophilum}
slaaidsmidpdisgpmrhivvkaihaagdfaiaplirysdgffksmlaklkegctiicd
semvragiysrpvlernrvvcylndvrskemadvngitrsaagiriamqdhrnsvivign
aptalleamrmieengwydipivgipvgfinaskakeglvsshieyisveghrggspiaa
sivngfgrfl

Timeline for d1ou0a_:

• d1ou0a_ first appeared in SCOP 1.67
  
• d1ou0a_ appears in SCOP 1.71
  
• d1ou0a_ appears in the current release, SCOPe 2.08