SCOP 1.67: Domain d1otwb_: 1otw B:

Lineage for d1otwb_ (1otw B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam 05312

6. Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)

8. Domain d1otwb_: 1otw B: [93529]
   complexed with peo, pqq; mutant

Details for d1otwb_

PDB Entry: 1otw, 2.3 Å

PDB Description: crystal structure of pqqc in complex with pqq and a putative h2o2

SCOP Domain Sequences for d1otwb_:

Sequence; same for both SEQRES and ATOM records:

>d1otwb_ a.132.1.4 (B:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvleh

Timeline for d1otwb_:

• d1otwb_ is new in SCOP 1.67
  
• d1otwb_ appears in SCOP 1.69
  
• d1otwb_ appears in the current release, SCOPe 2.08, called d1otwb1