Lineage for d1otwb1 (1otw B:2-251)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338543Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2338544Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2338765Family a.132.1.4: PqqC-like [101463] (2 protein domains)
    Pfam PF05312
  6. 2338766Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 2338775Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)
  8. 2338779Domain d1otwb1: 1otw B:2-251 [93529]
    Other proteins in same PDB: d1otwa2, d1otwa3, d1otwb2
    complexed with peo, pqq

Details for d1otwb1

PDB Entry: 1otw (more details), 2.3 Å

PDB Description: crystal structure of pqqc in complex with pqq and a putative h2o2
PDB Compounds: (B:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otwb1 a.132.1.4 (B:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlv

SCOPe Domain Coordinates for d1otwb1:

Click to download the PDB-style file with coordinates for d1otwb1.
(The format of our PDB-style files is described here.)

Timeline for d1otwb1: