SCOPe 2.07: Domain d1otwa1: 1otw A:1-251

Lineage for d1otwa1 (1otw A:1-251)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam PF05312

6. Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)

8. Domain d1otwa1: 1otw A:1-251 [93528]
   Other proteins in same PDB: d1otwa2, d1otwa3, d1otwb2
   complexed with peo, pqq

Details for d1otwa1

PDB Entry: 1otw, 2.3 Å

PDB Description: crystal structure of pqqc in complex with pqq and a putative h2o2

PDB Compounds: (A:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otwa1:

Sequence; same for both SEQRES and ATOM records:

>d1otwa1 a.132.1.4 (A:1-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
mlitdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplk
daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrl
sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
dkaawhttrlv

Timeline for d1otwa1:

• d1otwa1 first appeared in SCOP 1.67, called d1otwa_
  
• d1otwa1 appears in SCOPe 2.06
  
• d1otwa1 appears in the current release, SCOPe 2.08