Lineage for d1otwa1 (1otw A:1-251)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011636Family a.132.1.4: PqqC-like [101463] (2 protein domains)
    Pfam PF05312
  6. 2011637Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 2011646Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)
  8. 2011649Domain d1otwa1: 1otw A:1-251 [93528]
    Other proteins in same PDB: d1otwa2, d1otwa3, d1otwb2
    complexed with peo, pqq

Details for d1otwa1

PDB Entry: 1otw (more details), 2.3 Å

PDB Description: Crystal structure of PqqC in complex with PQQ and a putative H2O2
PDB Compounds: (A:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otwa1 a.132.1.4 (A:1-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
mlitdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplk
daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrl
sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
dkaawhttrlv

SCOPe Domain Coordinates for d1otwa1:

Click to download the PDB-style file with coordinates for d1otwa1.
(The format of our PDB-style files is described here.)

Timeline for d1otwa1: