SCOPe 2.07: Domain d1otvb1: 1otv B:2-251

Lineage for d1otvb1 (1otv B:2-251)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam PF05312

6. Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)

8. Domain d1otvb1: 1otv B:2-251 [93527]
   Other proteins in same PDB: d1otva2, d1otvb2

Details for d1otvb1

PDB Entry: 1otv, 2.1 Å

PDB Description: pqqc, pyrroloquinolinquinone synthase c

PDB Compounds: (B:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otvb1:

Sequence; same for both SEQRES and ATOM records:

>d1otvb1 a.132.1.4 (B:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlv

Timeline for d1otvb1:

• d1otvb1 first appeared in SCOP 1.67, called d1otvb_
  
• d1otvb1 appears in SCOPe 2.06
  
• d1otvb1 appears in the current release, SCOPe 2.08