Lineage for d1otvb1 (1otv B:2-251)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015546Family a.132.1.4: PqqC-like [101463] (2 proteins)
    Pfam PF05312
  6. 2015547Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 2015556Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)
  8. 2015558Domain d1otvb1: 1otv B:2-251 [93527]
    Other proteins in same PDB: d1otva2, d1otvb2

Details for d1otvb1

PDB Entry: 1otv (more details), 2.1 Å

PDB Description: pqqc, pyrroloquinolinquinone synthase c
PDB Compounds: (B:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otvb1 a.132.1.4 (B:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlv

SCOPe Domain Coordinates for d1otvb1:

Click to download the PDB-style file with coordinates for d1otvb1.
(The format of our PDB-style files is described here.)

Timeline for d1otvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1otvb2