Lineage for d1otvb_ (1otv B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505047Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1505048Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1505258Family a.132.1.4: PqqC-like [101463] (2 proteins)
    Pfam PF05312
  6. 1505259Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 1505266Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)
  8. 1505268Domain d1otvb_: 1otv B: [93527]

Details for d1otvb_

PDB Entry: 1otv (more details), 2.1 Å

PDB Description: pqqc, pyrroloquinolinquinone synthase c
PDB Compounds: (B:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otvb_ a.132.1.4 (B:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvlehh

SCOPe Domain Coordinates for d1otvb_:

Click to download the PDB-style file with coordinates for d1otvb_.
(The format of our PDB-style files is described here.)

Timeline for d1otvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otva_