SCOP 1.67: Domain d1otvb_: 1otv B:

Lineage for d1otvb_ (1otv B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam 05312

6. Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)

8. Domain d1otvb_: 1otv B: [93527]
   mutant

Details for d1otvb_

PDB Entry: 1otv, 2.1 Å

PDB Description: pqqc, pyrroloquinolinquinone synthase c

SCOP Domain Sequences for d1otvb_:

Sequence; same for both SEQRES and ATOM records:

>d1otvb_ a.132.1.4 (B:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvlehh

Timeline for d1otvb_:

• d1otvb_ is new in SCOP 1.67
  
• d1otvb_ appears in SCOP 1.69
  
• d1otvb_ appears in the current release, SCOPe 2.08, called d1otvb1