Lineage for d1otvb_ (1otv B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361144Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 361145Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 361208Family a.132.1.4: PqqC-like [101463] (2 protein domains)
    Pfam 05312
  6. 361209Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (1 species)
  7. 361210Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)
  8. 361212Domain d1otvb_: 1otv B: [93527]
    mutant

Details for d1otvb_

PDB Entry: 1otv (more details), 2.1 Å

PDB Description: PqqC, Pyrroloquinolinquinone Synthase C

SCOP Domain Sequences for d1otvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otvb_ a.132.1.4 (B:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvlehh

SCOP Domain Coordinates for d1otvb_:

Click to download the PDB-style file with coordinates for d1otvb_.
(The format of our PDB-style files is described here.)

Timeline for d1otvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otva_