Lineage for d1otva_ (1otv A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1750185Family a.132.1.4: PqqC-like [101463] (2 proteins)
    Pfam PF05312
  6. 1750186Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 1750195Species Klebsiella pneumoniae [TaxId:573] [101465] (2 PDB entries)
  8. 1750196Domain d1otva_: 1otv A: [93526]

Details for d1otva_

PDB Entry: 1otv (more details), 2.1 Å

PDB Description: pqqc, pyrroloquinolinquinone synthase c
PDB Compounds: (A:) Coenzyme PQQ synthesis protein C

SCOPe Domain Sequences for d1otva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}
litdtlspqafeealrakgdfyhihhpyhiamhngdatrkqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfyfrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvlehh

SCOPe Domain Coordinates for d1otva_:

Click to download the PDB-style file with coordinates for d1otva_.
(The format of our PDB-style files is described here.)

Timeline for d1otva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otvb_