SCOP 1.67: Domain d1otoa_: 1oto A:

Lineage for d1otoa_ (1oto A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (8 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (3 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein Internalin B [52060] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [52061] (6 PDB entries)

8. Domain d1otoa_: 1oto A: [93525]
   complexed with ca; mutant

Details for d1otoa_

PDB Entry: 1oto, 1.96 Å

PDB Description: calcium-binding mutant of the internalin b lrr domain

SCOP Domain Sequences for d1otoa_:

Sequence; same for both SEQRES and ATOM records:

>d1otoa_ c.10.2.1 (A:) Internalin B {Listeria monocytogenes}
etitvstpikqifpddafaetikanlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
sknhisdlralaglknldvlelfsqec

Timeline for d1otoa_:

• d1otoa_ is new in SCOP 1.67
  
• d1otoa_ appears in SCOP 1.69
  
• d1otoa_ appears in the current release, SCOPe 2.08