Lineage for d1otma_ (1otm A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834753Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 1834767Protein Internalin B [52060] (1 species)
  7. 1834768Species Listeria monocytogenes [TaxId:1639] [52061] (6 PDB entries)
  8. 1834772Domain d1otma_: 1otm A: [93523]
    mutant

Details for d1otma_

PDB Entry: 1otm (more details), 1.93 Å

PDB Description: calcium-binding mutant of the internalin b lrr domain
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d1otma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otma_ c.10.2.1 (A:) Internalin B {Listeria monocytogenes [TaxId: 1639]}
etitvstpikqifpdaafaetikanlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
sknhisdlralaglknldvlelfsqec

SCOPe Domain Coordinates for d1otma_:

Click to download the PDB-style file with coordinates for d1otma_.
(The format of our PDB-style files is described here.)

Timeline for d1otma_: