Lineage for d1otkb_ (1otk B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441519Protein Phenylacetic acid degradation protein PaaC [101136] (1 species)
  7. 441520Species Escherichia coli [TaxId:562] [101137] (1 PDB entry)
  8. 441522Domain d1otkb_: 1otk B: [93522]
    structural genomics

Details for d1otkb_

PDB Entry: 1otk (more details), 2 Å

PDB Description: structural genomics, protein paac

SCOP Domain Sequences for d1otkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otkb_ a.25.1.2 (B:) Phenylacetic acid degradation protein PaaC {Escherichia coli}
hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
qrvl

SCOP Domain Coordinates for d1otkb_:

Click to download the PDB-style file with coordinates for d1otkb_.
(The format of our PDB-style files is described here.)

Timeline for d1otkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otka_