Lineage for d1otka_ (1otk A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) 
Protein Phenylacetic acid degradation protein PaaC [101136] (1 species) Species Escherichia coli [TaxId:562] [101137] (1 PDB entry) 
Domain d1otka_: 1otk A: [93521]
structural genomics
Details for d1otka_
PDB Entry: 1otk (more details), 2 Å
PDB Description: structural genomics, protein paac
PDB Compounds: (A:) Phenylacetic acid degradation protein paaCSCOPe Domain Sequences for d1otka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otka_ a.25.1.2 (A:) Phenylacetic acid degradation protein PaaC {Escherichia coli [TaxId: 562]}
hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
qrvl
SCOPe Domain Coordinates for d1otka_:
Click to download the PDB-style file with coordinates for d1otka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1otka_:
- d1otka_ first appeared in SCOP 1.67
- d1otka_ appears in SCOPe 2.04
- d1otka_ is called d1otka1 in SCOPe 2.06
- d1otka_ appears in the current release, SCOPe 2.08, called d1otka1
View in 3D
