Lineage for d1otia_ (1oti A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417123Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 417184Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 417185Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 417186Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 417187Species Ectothiorhodospira halophila [TaxId:17] [55788] (24 PDB entries)
  8. 417201Domain d1otia_: 1oti A: [93516]
    complexed with hc4; mutant

Details for d1otia_

PDB Entry: 1oti (more details), 1.4 Å

PDB Description: e46q mutant of photoactive yellow protein, p65 at 295k

SCOP Domain Sequences for d1otia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otia_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d1otia_:

Click to download the PDB-style file with coordinates for d1otia_.
(The format of our PDB-style files is described here.)

Timeline for d1otia_: