Lineage for d1otea_ (1ote A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665549Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1665550Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 1665551Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 1665552Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (62 PDB entries)
    Uniprot P16113
  8. 1665577Domain d1otea_: 1ote A: [93515]
    complexed with hc4; mutant

Details for d1otea_

PDB Entry: 1ote (more details), 1.4 Å

PDB Description: e46q mutant of photoactive yellow protein, p65 at 110k
PDB Compounds: (A:) photoactive yellow protein, PYP

SCOPe Domain Sequences for d1otea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otea_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv

SCOPe Domain Coordinates for d1otea_:

Click to download the PDB-style file with coordinates for d1otea_.
(The format of our PDB-style files is described here.)

Timeline for d1otea_: