SCOP 1.67: Domain d1otea_: 1ote A:

Lineage for d1otea_ (1ote A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (24 PDB entries)

8. Domain d1otea_: 1ote A: [93515]
   complexed with hc4; mutant

Details for d1otea_

PDB Entry: 1ote, 1.4 Å

PDB Description: e46q mutant of photoactive yellow protein, p65 at 110k

SCOP Domain Sequences for d1otea_:

Sequence; same for both SEQRES and ATOM records:

>d1otea_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv

Timeline for d1otea_:

• d1otea_ is new in SCOP 1.67
  
• d1otea_ appears in SCOP 1.69
  
• d1otea_ appears in the current release, SCOPe 2.08