SCOP 1.73: Domain d1otdb_: 1otd B:

Lineage for d1otdb_ (1otd B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (40 PDB entries)

8. Domain d1otdb_: 1otd B: [93514]
   complexed with hc4

Details for d1otdb_

PDB Entry: 1otd, 1.25 Å

PDB Description: strong hydrogen bonds in photoactive yellow protein and their role in its photocycle

PDB Compounds: (B:) Photoactive yellow protein

SCOP Domain Sequences for d1otdb_:

Sequence; same for both SEQRES and ATOM records:

>d1otdb_ d.110.3.1 (B:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
sqldnlafgaiqldgdgtilqynaaegditgrnpkevigknffkdvapctdspefsgkfk
egvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv

Timeline for d1otdb_:

• d1otdb_ first appeared in SCOP 1.67
  
• d1otdb_ appears in SCOP 1.71
  
• d1otdb_ appears in SCOP 1.75
  
• d1otdb_ appears in the current release, SCOPe 2.08