SCOP 1.71: Domain d1otaa_: 1ota A:

Lineage for d1otaa_ (1ota A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (27 PDB entries)

8. Domain d1otaa_: 1ota A: [93511]
   complexed with hc4; mutant

Details for d1otaa_

PDB Entry: 1ota, 1.1 Å

PDB Description: e46q mutant of photoactive yellow protein, p63 at 295k

SCOP Domain Sequences for d1otaa_:

Sequence; same for both SEQRES and ATOM records:

>d1otaa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1otaa_:

• d1otaa_ first appeared in SCOP 1.67
  
• d1otaa_ appears in SCOP 1.69
  
• d1otaa_ appears in SCOP 1.73
  
• d1otaa_ appears in the current release, SCOPe 2.08