SCOPe 2.08: Domain d1ot8c_: 1ot8 C:

Lineage for d1ot8c_ (1ot8 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Neurogenic locus notch receptor domain [102879] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102880] (1 PDB entry)

8. Domain d1ot8c_: 1ot8 C: [93509]
   complexed with mg
   applies to all domains of a family if the common domain is composed of a different number of small repeating units
   has additional insertions and/or extensions that are not grouped together

Details for d1ot8c_

PDB Entry: 1ot8, 2 Å

PDB Description: structure of the ankyrin domain of the drosophila notch receptor

PDB Compounds: (C:) Neurogenic locus Notch protein

SCOPe Domain Sequences for d1ot8c_:

Sequence; same for both SEQRES and ATOM records:

>d1ot8c_ d.211.1.1 (C:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdktgetslhlaarfaradaakrlldagadansqdntgrtplhaavaadamgvfqillrn
ratnlnarmhdgttplilaarlaiegmvedlitadadinaadnsgktalhwaaavnntea
vnillmhhanrdaqddkdetplflaaregsyeaskalldnfanreitdhmdrlprdvase
rlhhdivrllde

Timeline for d1ot8c_:

• d1ot8c_ first appeared in SCOP 1.67
  
• d1ot8c_ appears in SCOPe 2.07