![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein Neurogenic locus notch receptor domain [102879] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102880] (1 PDB entry) |
![]() | Domain d1ot8b_: 1ot8 B: [93508] complexed with mg applies to all domains of a family if the common domain is composed of a different number of small repeating units has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ot8 (more details), 2 Å
SCOPe Domain Sequences for d1ot8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ot8b_ d.211.1.1 (B:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} llaqgaelnatmdktgetslhlaarfaradaakrlldagadansqdntgrtplhaavaad amgvfqillrnratnlnarmhdgttplilaarlaiegmvedlitadadinaadnsgktal hwaaavnnteavnillmhhanrdaqddkdetplflaaregsyeaskalldnfanreitdh mdrlprdvaserlhhdivrlldeh
Timeline for d1ot8b_: